SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410025 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000410025
Domain Number - Region: 86-125
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0879
Family Aldose 1-epimerase (mutarotase) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410025   Gene: ENSG00000213047   Transcript: ENST00000422998
Sequence length 147
Comment pep:putative chromosome:GRCh38:1:197642773:197775633:-1 gene:ENSG00000213047 transcript:ENST00000422998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKMKEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLC
ILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVHSYFIAP
DVTGLPTIPESRNLTEYFVAVDVNNML
Download sequence
Identical sequences A0A2J8KI06 B7ZBL5
ENSP00000410025 ENSP00000410025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]