SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410263 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410263
Domain Number 1 Region: 13-155
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.54e-44
Family Mismatch glycosylase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410263   Gene: ENSG00000132781   Transcript: ENST00000412971
Sequence length 215
Comment pep:novel chromosome:GRCh38:1:45331734:45340381:-1 gene:ENSG00000132781 transcript:ENST00000412971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVSRLSRLWEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVG
RYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQQLWGLAQQLVDPARPG
DFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQEQLLASGSLSGSPDVEECAPNT
GQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREES
Download sequence
Identical sequences Q5T418
ENSP00000410263 ENSP00000410263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]