SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410883 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410883
Domain Number 1 Region: 49-301
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 4.84e-64
Family Iron-containing alcohol dehydrogenase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410883   Gene: ENSG00000147576   Transcript: ENST00000424777
Sequence length 303
Comment pep:known chromosome:GRCh38:8:66432498:66468809:1 gene:ENSG00000147576 transcript:ENST00000424777 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAV
TKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNS
TDK
Download sequence
Identical sequences ENSP00000368695 ENSP00000410883 ENSP00000410883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]