SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411066 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411066
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000493
Family DNA gyrase/MutL, second domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411066   Gene: ENSG00000076242   Transcript: ENST00000458009
Sequence length 95
Comment pep:known chromosome:GRCh38:3:37012082:37028847:1 gene:ENSG00000076242 transcript:ENST00000458009 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETV
YAAYLPKNTHPFLYLRLCYQDLLAPLGRWLNPQQV
Download sequence
Identical sequences H0Y793
ENSP00000411066 ENSP00000411066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]