SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411085 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411085
Domain Number 1 Region: 57-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.16e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 333-426
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.07e-20
Family Anticodon-binding domain of Class II aaRS 0.0044
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000165
Family a tRNA synthase domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411085   Gene: ENSG00000170445   Transcript: ENST00000415192
Sequence length 435
Comment pep:novel chromosome:GRCh38:5:140674201:140691341:-1 gene:ENSG00000170445 transcript:ENST00000415192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKDFDIAGNFDPMIPDAECLKI
MCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMV
GEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGI
DDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKG
RKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDA
GIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDL
VEEIKRRTGQPLCIC
Download sequence
Identical sequences B4DDD8
NP_001276021.1.87134 NP_001276021.1.92137 ENSP00000411085 ENSP00000411085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]