SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411086 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411086
Domain Number 1 Region: 66-167
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.88e-34
Family Pointed domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411086   Gene: ENSG00000157557   Transcript: ENST00000456966
Sequence length 270
Comment pep:known chromosome:GRCh38:21:38809636:38818646:1 gene:ENSG00000157557 transcript:ENST00000456966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNS
Download sequence
Identical sequences A0A2J8M7V5 C9JAG2
ENSP00000411086 ENSP00000411086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]