SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411464 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411464
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000352
Family Eps15 homology domain (EH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411464   Gene: ENSG00000205726   Transcript: ENST00000456489
Sequence length 60
Comment pep:putative chromosome:GRCh38:21:33735041:33735626:1 gene:ENSG00000205726 transcript:ENST00000456489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGGNSV
Download sequence
Identical sequences H7C3F1
ENSP00000411464 ENSP00000411464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]