SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411596 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000411596
Domain Number - Region: 42-103
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411596   Gene: ENSG00000227122   Transcript: ENST00000441129
Sequence length 225
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MCF_CTG1:32224781:32229505:-1 gene:ENSG00000227122 transcript:ENST00000441129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTQTPAPAEDPHSGCRDPVPARPQACHPKSQETRFEGPLPPPPPAAAAPPPPAPAQTA
QAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTST
LPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGIIAIFKAVQVRTALARGDMVSA
EIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHHENYWDP
Download sequence
Identical sequences ENSP00000364292 ENSP00000364294 ENSP00000372799 ENSP00000394808 ENSP00000396426 ENSP00000411183 ENSP00000411544 ENSP00000411596 ENSP00000416064 ENSP00000447380 ENSP00000448469 ENSP00000449065 ENSP00000449638 ENSP00000449685 ENSP00000449975 ENSP00000450235 ENSP00000364292 ENSP00000372799 ENSP00000394808 ENSP00000396426 ENSP00000411183 ENSP00000411544 ENSP00000411596 ENSP00000416064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]