SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000411674 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411674
Domain Number 1 Region: 70-207
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-28
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411674   Gene: ENSG00000114346   Transcript: ENST00000444250
Sequence length 209
Comment pep:novel chromosome:GRCh38:3:172762787:172783880:1 gene:ENSG00000114346 transcript:ENST00000444250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLA
QLSRETDVSPFPPHTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQL
FQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFL
KYSKDLVKTYPPFVNFFEMSKETIIKCEK
Download sequence
Identical sequences H7C3G1
ENSP00000411674 ENSP00000411674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]