SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412076 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412076
Domain Number 1 Region: 466-545,762-952
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-61
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 2 Region: 26-146,184-233
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000226
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412076   Gene: ENSG00000172071   Transcript: ENST00000415570
Sequence length 956
Comment pep:putative chromosome:GRCh38:2:88557854:88595857:-1 gene:ENSG00000172071 transcript:ENST00000415570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYSEGGWSTSGSRLQLLITIILLKVFGNKMIIPSLDGALFQWDQDRESMETVPFTVESL
LESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQRT
QKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEEQ
EAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTSY
TSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNEN
AIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYY
LPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVR
RLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLGR
GGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEA
PPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSRS
FSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE
GHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAFK
PTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMN
GRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTA
MDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPF
STQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVF
Download sequence
Identical sequences C9J185
ENSP00000412076 ENSP00000412076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]