SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412107 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412107
Domain Number 1 Region: 75-146
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.32e-23
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000022
Family Matrix metalloproteases, catalytic domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412107   Gene: ENSG00000099953   Transcript: ENST00000434318
Sequence length 170
Comment pep:known chromosome:GRCh38:22:23780880:23783441:1 gene:ENSG00000099953 transcript:ENST00000434318 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALG
PQAGIDTNEIAPLEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALA
SRHWQGLPSPVDAAFEDAQGHIWFFQELGFPSSTGRDESLEHCRCQGLHK
Download sequence
Identical sequences H7C3I7
ENSP00000412107 ENSP00000412107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]