SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412245 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412245
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000000000386
Family D-ribulose-5-phosphate 3-epimerase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412245   Gene: ENSG00000197713   Transcript: ENST00000453724
Sequence length 94
Comment pep:known chromosome:GRCh38:2:210002634:210016597:1 gene:ENSG00000197713 transcript:ENST00000453724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKSCSVTQAEVQWHSQ
GPLQVGLAIKPGTSVEYLAPWANQIDMALVMTVE
Download sequence
Identical sequences A0A2J8N619 E9PBG9
ENSP00000412245 ENSP00000412245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]