SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412302 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412302
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily DNA-binding domain 4.9e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412302   Gene: ENSG00000071655   Transcript: ENST00000434436
Sequence length 291
Comment pep:known chromosome:GRCh38:19:1576678:1592708:-1 gene:ENSG00000071655 transcript:ENST00000434436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV
Download sequence
Identical sequences H2R3B9 O95983
ENSPTRP00000045258 9598.ENSPTRP00000045258 9606.ENSP00000156825 ENSP00000412302 NP_001268382.1.87134 NP_001268382.1.92137 XP_009432566.1.37143 HR6416 gi|4505119|ref|NP_003917.1| ENSPTRP00000045258 ENSP00000156825 ENSP00000156825 ENSP00000412302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]