SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412403 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412403
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000000000491
Family FKBP immunophilin/proline isomerase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412403   Gene: ENSG00000134285   Transcript: ENST00000444214
Sequence length 99
Comment pep:known chromosome:GRCh38:12:48921959:48924967:-1 gene:ENSG00000134285 transcript:ENST00000444214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGM
AMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences A0A2I3GKE6 E9PAR0 F6WUJ4
NP_001137253.1.87134 NP_001137253.1.92137 XP_003252256.1.23891 XP_003313776.1.37143 XP_008949396.1.60992 XP_009245950.1.23681 XP_011791610.1.43180 XP_012296723.1.9421 XP_017401229.1.71028 XP_018875712.1.27298 ENSCJAP00000042525 gi|219842217|ref|NP_001137253.1| ENSP00000412403 ENSP00000412403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]