SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412614 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412614
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-40
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412614   Gene: ENSG00000066248   Transcript: ENST00000458735
Sequence length 150
Comment pep:putative chromosome:GRCh38:2:232891349:232901440:-1 gene:ENSG00000066248 transcript:ENST00000458735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEH
RMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELD
PKCRGLPFSSFLILPFQRITRLKLLVQVQP
Download sequence
Identical sequences ENSP00000412614 ENSP00000412614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]