SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412818 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412818
Domain Number 1 Region: 90-198
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-25
Family DBL homology domain (DH-domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412818   Gene: ENSG00000090924   Transcript: ENST00000451354
Sequence length 198
Comment pep:known chromosome:GRCh38:19:39413812:39416597:1 gene:ENSG00000090924 transcript:ENST00000451354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAAPAAPTMASPRGSGSSTSLSTVG
SEGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVR
DLRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECF
VQRSEDFDIYTLYCMNYP
Download sequence
Identical sequences A0A2J8QFI2 C9JVL3
ENSP00000412818 ENSP00000412818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]