SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412910 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412910
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.79e-25
Family GAS2 domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412910   Gene: ENSG00000127603   Transcript: ENST00000422234
Sequence length 159
Comment pep:novel chromosome:GRCh38:1:39462020:39479994:1 gene:ENSG00000127603 transcript:ENST00000422234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALD
EFLVKNDPCRVHHPGSKIKRSDSSSSISSQSPIARGRTNIELREKFILPEGASQGMTPFR
SRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATP
Download sequence
Identical sequences A0A2J8LYQ4 A0A2J8Y6E9 H0Y7I1
ENSP00000412910 ENSP00000412910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]