SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413190
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.3e-38
Family Ran-binding protein mog1p 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413190   Gene: ENSG00000108961   Transcript: ENST00000439238
Sequence length 165
Comment pep:known chromosome:GRCh38:17:8288678:8290092:1 gene:ENSG00000108961 transcript:ENST00000439238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVRA
RECVMSWKGGSGDAEIQVSILTLIPLGSKGRDTSSGLAEAAPVPD
Download sequence
Identical sequences ENSP00000413190 gi|295317379|ref|NP_001171273.1| NP_001171273.1.87134 NP_001171273.1.92137 ENSP00000413190 GO.35126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]