SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413829 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413829
Domain Number 1 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 1.96e-37
Family Kringle modules 0.00000541
Further Details:      
 
Domain Number 2 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.55e-24
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413829   Gene: ENSG00000019991   Transcript: ENST00000423064
Sequence length 210
Comment pep:known chromosome:GRCh38:7:81750889:81770105:-1 gene:ENSG00000019991 transcript:ENST00000423064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEGK
Download sequence
Identical sequences A0A2J8VLK6 K7AMD5
gi|58533167|ref|NP_001010934.1| ENSP00000413829 ENSP00000413829 NP_001010934.1.87134 NP_001010934.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]