SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413833 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413833
Domain Number 1 Region: 154-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-56
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 342-474
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-31
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 452-493,531-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 605-701
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-21
Family Pleckstrin-homology domain (PH domain) 0.0000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413833   Gene: ENSG00000127084   Transcript: ENST00000416701
Sequence length 724
Comment pep:known chromosome:GRCh38:9:92963961:93036236:1 gene:ENSG00000127084 transcript:ENST00000416701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTETPTAD
PQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPD
PEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPMG
AAAP
Download sequence
Identical sequences ENSP00000413833 ENSP00000413833 NP_001273922.1.87134 NP_001273922.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]