SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414126 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414126
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 3.27e-51
Family Formyltransferase 0.00000000214
Further Details:      
 
Domain Number 2 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 8.16e-26
Family Post formyltransferase domain 0.000000881
Further Details:      
 
Domain Number 3 Region: 415-492
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000000245
Family ALDH-like 0.00063
Further Details:      
 
Domain Number 4 Region: 325-408
Classification Level Classification E-value
Superfamily ACP-like 0.00000245
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414126   Gene: ENSG00000144908   Transcript: ENST00000455064
Sequence length 505
Comment pep:known chromosome:GRCh38:3:126103562:126180802:-1 gene:ENSG00000144908 transcript:ENST00000455064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLMYRAPPSPSTRPDPTAT
Download sequence
Identical sequences A0A0S2Z586
ENSP00000377081 ENSP00000377081 ENSP00000414126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]