SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414243 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414243
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Globin-like 8.31e-22
Family Globins 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414243   Gene: ENSG00000198125   Transcript: ENST00000419229
Sequence length 77
Comment pep:known chromosome:GRCh38:22:35610970:35622524:-1 gene:ENSG00000198125 transcript:ENST00000419229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGIL
Download sequence
Identical sequences A0A2J8QPF0 F2Z337
ENSP00000414243 ENSP00000414243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]