SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414287 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414287
Domain Number 1 Region: 456-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-58
Family Eukaryotic proteases 0.0000358
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-34
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 204-287
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 111-202
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-31
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 5 Region: 295-378
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-30
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.33e-17
Family Hairpin loop containing domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414287   Gene: ENSG00000173531   Transcript: ENST00000449682
Sequence length 725
Comment pep:known chromosome:GRCh38:3:49683947:49689053:-1 gene:ENSG00000173531 transcript:ENST00000449682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWWVTVQPPARRMGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPW
QEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDY
VRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGG
PWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFE
PGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRG
KGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTL
RPGMRAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTF
TSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFE
KCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSS
CHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVAL
ICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMC
TEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHK
VMRLG
Download sequence
Identical sequences G3XAK1
9606.ENSP00000308226 ENSP00000414287 gi|205277383|ref|NP_066278.3| NP_066278.3.87134 NP_066278.3.92137 ENSP00000414287 ENSP00000373234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]