SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000415891 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415891
Domain Number 1 Region: 11-92
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000458
Family FKBP immunophilin/proline isomerase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415891   Gene: ENSG00000077800   Transcript: ENST00000445032
Sequence length 101
Comment pep:known chromosome:GRCh38:7:73328312:73358625:1 gene:ENSG00000077800 transcript:ENST00000445032 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEGRFRVGAGEEGIV
Download sequence
Identical sequences F8WD38
ENSP00000415891 ENSP00000415891 ENSP00000460987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]