SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000416125 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416125
Domain Number 1 Region: 78-296
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-49
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 334-515
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-38
Family BAR domain 0.0065
Further Details:      
 
Domain Number 3 Region: 569-657
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.0000866
Further Details:      
 
Domain Number 4 Region: 715-771
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-16
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416125   Gene: ENSG00000236699   Transcript: ENST00000420470
Sequence length 777
Comment pep:putative chromosome:GRCh38:4:105552622:105680913:1 gene:ENSG00000236699 transcript:ENST00000420470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREV
VQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKP
IQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINVNINELKRRKDLVLKYKKNDE
DESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCV
KNISLCLQHIQDAMPLALQSVMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLIL
TPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEESDLAKKEYEALNAQLVEELQAF
NQAARKILLNCLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCV
KENSATFIERKLSFEKKKPVQILPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYD
INLLEGDLVAVIEQKDPLGSTSRWLVDTGNVKGYVYSSFLKPYNPAKMQKVDAENRFCDD
DFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVDEQIFYA
VHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA
Download sequence
Identical sequences Q9NXL2
ENSP00000416125 NP_001229658.1.87134 NP_001229658.1.92137 ENSP00000416125 gi|337298620|ref|NP_001229658.1| ENSP00000416125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]