SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416217 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416217
Domain Number 1 Region: 27-85
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.43e-18
Family Acyl-CoA thioesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416217   Gene: ENSG00000101473   Transcript: ENST00000426915
Sequence length 92
Comment pep:putative chromosome:GRCh38:20:45853422:45857309:-1 gene:ENSG00000101473 transcript:ENST00000426915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQ
ALVAAAKSVSEDVHVHSLHCYFVRADALMCSA
Download sequence
Identical sequences A0A2J8MJW2 Q9BR14
ENSP00000416217 ENSP00000416217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]