SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417057 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000417057
Domain Number - Region: 7-35
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00667
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417057   Gene: ENSG00000068885   Transcript: ENST00000468218
Sequence length 42
Comment pep:putative chromosome:GRCh38:3:160366055:160399223:-1 gene:ENSG00000068885 transcript:ENST00000468218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNA
Download sequence
Identical sequences C9J6I5
ENSP00000417057 ENSP00000417057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]