SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000417087 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417087
Domain Number 1 Region: 103-183
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-17
Family DBL homology domain (DH-domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417087   Gene: ENSG00000163947   Transcript: ENST00000468727
Sequence length 184
Comment pep:putative chromosome:GRCh38:3:56751118:57079308:-1 gene:ENSG00000163947 transcript:ENST00000468727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSPKAWNFRGRKRKQSTQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPPVKATP
LKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSK
EIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEE
LLSQ
Download sequence
Identical sequences A0A2J8P7W3 C9J609
ENSP00000417087 ENSP00000417087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]