SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417172 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417172
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily ARM repeat 7.53e-39
Family Armadillo repeat 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417172   Gene: ENSG00000186432   Transcript: ENST00000483437
Sequence length 170
Comment pep:novel chromosome:GRCh38:3:160504958:160521796:-1 gene:ENSG00000186432 transcript:ENST00000483437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITA
GNQQQVQAVIDANLVPMIIHLLDKVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNIL
KMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDD
Download sequence
Identical sequences A0A1D5RGP8 A0A2J8P1X7 A0A2J8WTQ3 H7C4F6
ENSP00000417172 ENSP00000417172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]