SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000417596 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417596
Domain Number 1 Region: 7-206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-52
Family DBL homology domain (DH-domain) 0.00000000637
Further Details:      
 
Domain Number 2 Region: 198-322
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-37
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417596   Gene: ENSG00000102606   Transcript: ENST00000478679
Sequence length 547
Comment pep:putative chromosome:GRCh38:13:111241220:111292458:1 gene:ENSG00000102606 transcript:ENST00000478679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCSSQSVQKTRRGRKVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLM
GNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLT
EHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQK
SMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEK
NERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERI
LVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPL
TPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKS
PKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQG
TDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCC
SYISHQN
Download sequence
Identical sequences E9PDQ5
NP_001307783.1.87134 NP_001307783.1.92137 ENSP00000417596 ENSP00000417596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]