SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417612 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417612
Domain Number 1 Region: 11-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-25
Family ABC transporter ATPase domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417612   Gene: ENSG00000113810   Transcript: ENST00000485867
Sequence length 157
Comment pep:putative chromosome:GRCh38:3:160399669:160404504:1 gene:ENSG00000113810 transcript:ENST00000485867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY
RAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPNSNFYVSRTACRD
NTSVYHISGKKKTFKDVGNLLRSHGIDLDHNRFLILQ
Download sequence
Identical sequences C9J9E4
ENSP00000417612 ENSP00000417612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]