SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417623 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417623
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-36
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417623   Gene: ENSG00000105851   Transcript: ENST00000473541
Sequence length 182
Comment pep:putative chromosome:GRCh38:7:106865339:106883131:1 gene:ENSG00000105851 transcript:ENST00000473541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPY
DPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQI
LRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVL
NH
Download sequence
Identical sequences A0A2J8QY33 E9PDN7
ENSP00000417623 ENSP00000417623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]