SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000417687 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417687
Domain Number 1 Region: 57-505
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-150
Family ALDH-like 0.000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417687   Gene: ENSG00000112294   Transcript: ENST00000491546
Sequence length 507
Comment pep:novel chromosome:GRCh38:6:24494867:24533757:1 gene:ENSG00000112294 transcript:ENST00000491546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKGK
PLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPS
AMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVG
EAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGA
MASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKA
VEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIK
FDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVK
QSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences C9J8Q5
ENSP00000417687 ENSP00000417687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]