SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417778 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417778
Domain Number 1 Region: 19-129
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.000000000000949
Family 4HBT-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417778   Gene: ENSG00000123130   Transcript: ENST00000492081
Sequence length 136
Comment pep:putative chromosome:GRCh38:X:23707831:23743250:-1 gene:ENSG00000123130 transcript:ENST00000492081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDL
DSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSME
VKMQMFQAGICKSTHP
Download sequence
Identical sequences A0A2I2ZY27 A0A2I3RM93 A0A2J8W3Z9 C9J7L8
ENSP00000417778 ENSP00000417778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]