SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000417810 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417810
Domain Number 1 Region: 153-233
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-16
Family DBL homology domain (DH-domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417810   Gene: ENSG00000163947   Transcript: ENST00000465659
Sequence length 236
Comment pep:known chromosome:GRCh38:3:56728232:56801949:-1 gene:ENSG00000163947 transcript:ENST00000465659 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XVESCPARSRLSVSVSPPPPGIVELGPPFAWEFCSRLGSAVTSQRAGPAAAMVAKDYPFY
LTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQR
SISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFE
LSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEAPLPQLL
Download sequence
Identical sequences H7C4P0
ENSP00000417810 ENSP00000417810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]