SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418015 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418015
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-37
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418015   Gene: ENSG00000165060   Transcript: ENST00000498653
Sequence length 135
Comment pep:putative chromosome:GRCh38:9:69036161:69073105:1 gene:ENSG00000165060 transcript:ENST00000498653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVK
LGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK
TKLDLSSLAYSGKDA
Download sequence
Identical sequences A0A2J8MR46 C9JAX1
ENSP00000418015 ENSP00000418015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]