SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418067 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418067
Domain Number 1 Region: 83-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-52
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 276-400
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-37
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 8-79
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-25
Family SH3-domain 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418067   Gene: ENSG00000102606   Transcript: ENST00000466143
Sequence length 447
Comment pep:known chromosome:GRCh38:13:111153689:111283226:1 gene:ENSG00000102606 transcript:ENST00000466143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYV
REVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYL
RPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLK
ELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLG
NVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP
SHPVTPSSKHADSKPAPLTPAYHTLPH
Download sequence
Identical sequences E7EUY6
ENSP00000418067 ENSP00000418067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]