SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418219 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418219
Domain Number 1 Region: 30-144
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.11e-24
Family Peptidyl-tRNA hydrolase-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418219   Gene: ENSG00000187024   Transcript: ENST00000423807
Sequence length 182
Comment pep:novel chromosome:GRCh38:9:127713493:127716003:-1 gene:ENSG00000187024 transcript:ENST00000423807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARQCQGCGWVSGARRTLRRFRPMCWAASPLLSRSCCLCCWIEP
PT
Download sequence
Identical sequences C9J7Z1
ENSP00000418219 ENSP00000418219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]