SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418227
Domain Number 1 Region: 78-298
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-55
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 288-446
Classification Level Classification E-value
Superfamily PH domain-like 9.81e-20
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 3 Region: 431-498
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418227   Gene: ENSG00000050327   Transcript: ENST00000471847
Sequence length 519
Comment pep:novel chromosome:GRCh38:7:144366133:144380056:1 gene:ENSG00000050327 transcript:ENST00000471847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSE
SYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVD
HFQLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAP
DFRRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRIT
RLKLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFE
CKIFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFL
VFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALA
MPREELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGER
GWFPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA
Download sequence
Identical sequences A0A090N7S2
ENSP00000418227 ENSP00000418227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]