SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418396 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418396
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.06e-27
Family Transferrin 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418396   Gene: ENSG00000091513   Transcript: ENST00000494430
Sequence length 120
Comment pep:known chromosome:GRCh38:3:133746393:133755414:1 gene:ENSG00000091513 transcript:ENST00000494430 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDFLLCCCCGEEG
Download sequence
Identical sequences F8WCI6
ENSP00000418396 ENSP00000418396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]