SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418574 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418574
Domain Number 1 Region: 23-66
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.49e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000942
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418574   Gene: ENSG00000140307   Transcript: ENST00000484743
Sequence length 74
Comment pep:novel chromosome:GRCh38:15:59639113:59657520:-1 gene:ENSG00000140307 transcript:ENST00000484743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKI
VACDGKNTGSNTTE
Download sequence
Identical sequences A0A0B4J1Z5 A0A1D5Q7J7 A0A286XI79 A0A2I2ZEF4 A0A2I3GZ45 A0A2I3MGB4 A0A2I3T7P5 A0A2J8VCG4 A0A2K5KCB8 A0A2K5NCI6 A0A2K5WHQ2 A0A2K5ZG37 A0A2K6BLD3 A0A2K6FDR5 A0A2K6MZT2 A0A2K6R8N9
ENSP00000418574 ENSP00000418574 XP_005393885.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]