SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418611 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418611
Domain Number 1 Region: 1271-1450
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 1457-1577
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 3 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 4 Region: 1089-1226
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 5 Region: 840-992
Classification Level Classification E-value
Superfamily Spectrin repeat 6.52e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 35-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000968
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 8 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000929
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 9 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000432
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418611   Gene: ENSG00000160145   Transcript: ENST00000460856
Sequence length 1654
Comment pep:novel chromosome:GRCh38:3:124094681:124519849:1 gene:ENSG00000160145 transcript:ENST00000460856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQA
GHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRD
EDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPS
VASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQET
GEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEI
RKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANH
EVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHII
FGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEH
AGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSV
PKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSK
EIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQ
EWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGDGSSQPDTIS
IASRTSQNTVDSDKDGNLVPRWHLGPGDPFSTYV
Download sequence
Identical sequences C9IZQ6
NP_001309918.1.87134 NP_001309918.1.92137 ENSP00000418611 ENSP00000418611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]