SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418745 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418745
Domain Number 1 Region: 410-630
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-55
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 709-776
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-17
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 622-710
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000176
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418745   Gene: ENSG00000050327   Transcript: ENST00000474817
Sequence length 797
Comment pep:novel chromosome:GRCh38:7:144364909:144380631:1 gene:ENSG00000050327 transcript:ENST00000474817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQASDPAVARQHRPLPSTPDSSHHAQATPR
WRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLPPLPIIDPPTEPPPLPPKSRGRSRSTR
GGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPPATARSTESFTSTSRSKSEVSPGMAFS
NMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHPEAPAREPLRRTTPQQGASGPGRSPVG
QARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSGQAVAPSEGANKHKGWSRQGLRRPSIL
PEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMGGFSRRCSKLINSSQLLYQEYSDVVLN
KEIQSQQRLESLSETPGPSSPRQPRKALVSSESYLQRLSMASSGSLWQEIPVVRNSTVLL
SMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWLFSRLQDVR
DVSATFLSDLEENFENNIFSFQVCDVVLNHAPDFRRVYLPYVTNQTYQERTFQSLMNSNS
NFREVLEKLESDPVCQRLSLKSFLILPFQRITRLKLLLQNILKRTQPGSSEEAEATKAHH
ALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECKIFPLISQSRWLVKSGELTALEFSASP
GLRRKLNTRPVHLHLFNDCLLLSRPRESEKLRWISALAMPREELDLLECYNSPQVQCLRA
YKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGWFPVQQVEFISNPEVRAQNLK
EAHRVKTAKLQLVEQQA
Download sequence
Identical sequences H0Y895
ENSP00000418745 ENSP00000418745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]