SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418976 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418976
Domain Number 1 Region: 11-59
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000776
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418976   Gene: ENSG00000144847   Transcript: ENST00000483401
Sequence length 59
Comment pep:putative chromosome:GRCh38:3:118928578:119013237:-1 gene:ENSG00000144847 transcript:ENST00000483401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTY
Download sequence
Identical sequences A0A2J8M3C5 A0A2J8W2K5 C9IZX3
ENSP00000418976 ENSP00000418976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]