SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419243 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419243
Domain Number 1 Region: 22-95
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 9.94e-27
Family Frataxin-like 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419243   Gene: ENSG00000165060   Transcript: ENST00000484259
Sequence length 108
Comment pep:novel chromosome:GRCh38:9:69046407:69072796:1 gene:ENSG00000165060 transcript:ENST00000484259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPDLECQKAECLFDEFEEIWNFGPPRSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSG
PKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Download sequence
Identical sequences H7C585
ENSP00000419243 ENSP00000419243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]