SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419338 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419338
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.46e-56
Family Transferrin 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419338   Gene: ENSG00000091513   Transcript: ENST00000482271
Sequence length 134
Comment pep:putative chromosome:GRCh38:3:133746393:133756923:1 gene:ENSG00000091513 transcript:ENST00000482271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFP
QLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCL
DNTRKPVDEYKDCH
Download sequence
Identical sequences A0A2J8QJ23 C9JVG0
ENSP00000419338 ENSP00000419338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]