SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419496 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000419496
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily E set domains 0.077
Family Arrestin/Vps26-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419496   Gene: ENSG00000157538   Transcript: ENST00000476950
Sequence length 270
Comment pep:novel chromosome:GRCh38:21:37225472:37267346:-1 gene:ENSG00000157538 transcript:ENST00000476950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFE
AFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQPQK
GKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIR
SVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTN
FKVEFEVNIVVLLHPDHLITENFPLKLCRI
Download sequence
Identical sequences XP_005260966.1.92137 ENSP00000419496 ENSP00000419496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]