SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420010 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420010
Domain Number 1 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 8.71e-20
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 2 Region: 157-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000666
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSP00000420010
Domain Number - Region: 258-303
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0267
Family YkuI C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420010   Gene: ENSG00000026950   Transcript: ENST00000476549
Sequence length 352
Comment pep:known chromosome:GRCh38:6:26402237:26413246:1 gene:ENSG00000026950 transcript:ENST00000476549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWS
NNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADP
FFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQ
EQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPGEEMLQMRLHFVK
Download sequence
Identical sequences NP_919423.1.87134 NP_919423.1.92137 XP_005248891.1.92137 gi|37221189|ref|NP_919423.1| ENSP00000420010 ENSP00000420010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]