SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420070 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420070
Domain Number 1 Region: 618-820
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-37
Family DBL homology domain (DH-domain) 0.00000439
Further Details:      
 
Domain Number 2 Region: 833-960
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-27
Family Pleckstrin-homology domain (PH domain) 0.00027
Further Details:      
 
Domain Number 3 Region: 318-423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000336
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 100-194
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000249
Family CRAL/TRIO domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420070   Gene: ENSG00000053524   Transcript: ENST00000473233
Sequence length 1074
Comment pep:known chromosome:GRCh38:3:183178050:183427977:-1 gene:ENSG00000053524 transcript:ENST00000473233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCLKEEMPPQELTRRLATVITHVDEIMQQEVRPLMAVEIIEQLHRQFAILSGGRGEDG
APIITFPEFSGFKHIPDEDFLNVMTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTR
IAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYRNEFKTKVPIIMVNSVSDLHGYIDKSQ
LTRELGGTLEYRHGQWVNHRTAIENFALTLKTTAQMLQTFGSCLATAELPRSMLSTEDLL
MSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDE
TEKAFSHFWSEHHLKLNQCLQLQHFEHDFCKAKLALDNLLEEQAEFTGIGDSVMHVEQIL
KEHKKLEEKSQEPLEKAQLLALVGDQLIQSHHYAADAIRPRCVELRHLCDDFINGNKKKW
DILGKSLEFHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDIALNDIATFLGTVKEYPL
LSPKEFYNEFELLLTLDAKAKAQKVLQRLDDVQEIFHKRQVSLMKLAAKQTRPVQPVAPH
PESSPKWVSSKTSQPSTSVPLARPLRTSEEPYTETELNSRGKEDDETKFEVKSEEIFESH
HERGNPELEQQARLGDLSPRRRIIRDLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPD
VLQNNKDFLFGNIRELYEFHNRTFLKELEKCAENPELLAHCFLKRKEDLQIYFKYHKNLP
RARAIWQECQDCAYFGVCQRQLDHNLPLFKYLKGPSQRLIKYQMLLKGLLDFESPEDMEI
DPGELGGSAKDGPKRTKDSAFSTELQQALAVIEDLIKSCELAVDLAAVTECPDDIGKLGK
LLLHGPFSVWTIHKDRYKMKDLIRFKPSQRQIYLFERGIVFCKIRMEPGDQGLSPHYSFK
KTMKLMTLSIRQLGRGSHRKFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNI
KDQGNPQFEMSTSKGSGAGSGPWIKNMERATTSKEDPASSTGGIKGCSSREFSSMDTFED
CEGAEDMEKESSALSLAGLFQSDDSHETCSSKSAFLERGESSQGEKEERDEEET
Download sequence
Identical sequences ENSP00000420070 ENSP00000420070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]