SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420161 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420161
Domain Number 1 Region: 74-342
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.88e-57
Family beta 1,4 galactosyltransferase (b4GalT1) 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420161   Gene: ENSG00000121578   Transcript: ENST00000483209
Sequence length 344
Comment pep:known chromosome:GRCh38:3:119211732:119240639:-1 gene:ENSG00000121578 transcript:ENST00000483209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKG
KTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKA
LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAE
RMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
Download sequence
Identical sequences B2RAZ5 O60513
gi|47078258|ref|NP_997708.1| gi|9994175|ref|NP_003769.1| ENSP00000352144 ENSP00000377360 ENSP00000420161 9606.ENSP00000352144 ENSP00000352144 ENSP00000377360 ENSP00000420161 NP_003769.1.87134 NP_003769.1.92137 NP_997708.1.87134 NP_997708.1.92137 XP_005247912.1.92137 XP_006713861.1.92137 XP_006713862.1.92137 XP_006713863.1.92137 XP_006713864.1.92137 XP_011511562.1.92137 ENSP00000377360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]